PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 177aa    MW: 20034.7 Da    PI: 6.9915
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594297.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.64.9e-3941031100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++ Cv+apyfp ++++++a++hk+FGas+v+k+l++l++++r+da++slvyeA+  + dPv+G+  ++ +lq+ql+ l+ +l+
  XP_013594297.1   4 PCAACKYLRRKCTQACVFAPYFPPNKQEDYAAIHKVFGASQVTKILNDLHPSQRQDAVTSLVYEAQTLLLDPVHGCSPHVYNLQRQLKDLQDQLH 98 
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +++e
  XP_013594297.1  99 IARNE 103
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1993104IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-384101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSTPCAACKY LRRKCTQACV FAPYFPPNKQ EDYAAIHKVF GASQVTKILN DLHPSQRQDA  60
VTSLVYEAQT LLLDPVHGCS PHVYNLQRQL KDLQDQLHIA RNELASYNNI VPPLDLPPPI  120
TYQQNHHNPM LMPVVSNYDG PLTQQLHEEA HRVESERSAQ VQQMQPNAAP SKRDDCP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013730640.11e-129PREDICTED: LOB domain-containing protein 28-like
RefseqXP_013594297.11e-129PREDICTED: LOB domain-containing protein 28
SwissprotQ9SCS41e-56LBD28_ARATH; LOB domain-containing protein 28
TrEMBLA0A078IX901e-130A0A078IX90_BRANA; BnaC01g42240D protein
TrEMBLA0A0D3A9Q71e-130A0A0D3A9Q7_BRAOL; Uncharacterized protein
STRINGBra030013.1-P1e-105(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.12e-50LOB domain-containing protein 28